SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014416 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014416
Domain Number 1 Region: 1293-1431
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000151
Further Details:      
 
Domain Number 2 Region: 187-287
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000367
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014416   Gene: ENSOPRG00000015770   Transcript: ENSOPRT00000015779
Sequence length 1437
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1485:5768:81752:1 gene:ENSOPRG00000015770 transcript:ENSOPRT00000015779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVPEELQEPFYTDQYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKLLGHDAVMQALA
QKGLYVTDQEKLVTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSVEKVITCAQQYSAFF
QATDLPYDIEDAVMYWINKVNEHLKDIMEQEQKLKEHHTVEAPGGQKSPSKWFWKLVPAR
YRKEQTLLKQLPCIPLVENLLKDGTDGCALAALIHFYCPGVVRLEDICLKETMSLADSLY
NLQLIQEFCQEYLNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVIH
PQGAEPVKDPPSAPALSTARRNVSDGSWSSRFTSXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNE
GLTLNNRMSRHITIKYFPVNREEETESSEEEDIGSHGDLRSYMPNTNELNSNENIPYKLP
NEALQNRILLDEFGNQIETPSIEEALQIIHDTEKSPHTPQPDRIANGFFLHSQEMSILNS
NIKLNQSSPDNITDTKGALSPVTDNTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDM
DDASKFLQDYDLRTSNPREALSPCPSTVSTKSQPGSSASSSSGLKMTSFAEQKFKKLNHT
DGKSSGSSSQKTTPEGSELNIPHVVAWAQIPEETGLPQGRDTTQLLASEMVHLRMKLEEK
RRAIEAQKKKMEAAFTKQRQKMGRTAFLTVVKKKGDGIAPLREEAAGAEDEKVYTDRAKD
TESQKPHGQRSKSLADLKESMENPPAKWLKSPTTPVDPEKQWNLASPSEENLNEGEILEY
TKSIEKLNSSLHFLQQEMQRLSLQQEMLMQMREQQSWVISPPQPSPQKQIRDFKSSRQAG
LSSTTASFSDSPRPTHPSPQSSNRKSTSFSAKNQRTPRPNELKITPLNRTLTPPRSVDSL
PRLRRFSPSQVPIQTRSFVCFGDDGDPQLKESKPKDEVKKEELEPKGTSDRHGHNPEEKE
IKPLESMVSEVLSQPVTETVCLTPNQDQLSQPVEPPPKPIFPSTAPKNVNLIEVSLSDLK
PPEKTDVSVEKYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKE
TQLRKQQLEAEMEHKKEETRRKTEEERQKKEDEKARREFIRQEYMRRKQLKLMEDMDTVI
KSRPQGTKQKKQRPKSIHRDHIESPKTPVKGPPVSSLSLASLTTGDNESLHSGKRTPRSE
SVEGFLSPSRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHC
CLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKS
ITKKMIEGLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKP
Download sequence
Identical sequences ENSOPRP00000014416 ENSOPRP00000014416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]