SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014474 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014474
Domain Number 1 Region: 431-536,658-804
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.19e-62
Family Phosphate binding protein-like 0.00000000235
Further Details:      
 
Domain Number 2 Region: 91-251
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000765
Family L-arabinose binding protein-like 0.032
Further Details:      
 
Domain Number 3 Region: 560-655
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000772
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014474   Gene: ENSOPRG00000015836   Transcript: ENSOPRT00000015842
Sequence length 893
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1765:14612:371953:1 gene:ENSOPRG00000015836 transcript:ENSOPRT00000015842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARQKKMGQSVLRAVFFLVLGLLGRSHGGFPNTISIXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVRLVIQMPALKGAILSLLXXXXXXXXXXXXXXXXXFSILQAIMEAA
VQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHSR
GYHYMLANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYG
ARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSK
PGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPN
EFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERM
VSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADG
VARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLA
VLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMMV
ALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
Download sequence
Identical sequences ENSOPRP00000014474 ENSOPRP00000014474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]