SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014537 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014537
Domain Number 1 Region: 32-518
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-148
Family ALDH-like 0.000000000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014537   Gene: ENSOPRG00000015920   Transcript: ENSOPRT00000015916
Sequence length 523
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2619:69541:89921:-1 gene:ENSOPRG00000015920 transcript:ENSOPRT00000015916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSWPRWAVLSPLLSRTLRSARVVAAATMSTGTFVVSQPLNYRGGARVEPADSSGTEKAF
EPATGRVIATFTCSGAKEVDLAVESAKAAFKIWSKKSGMERCHILLEAARIIRERRDEIA
TMETINNGKSIFEARWDIDTSWQCLEYYAGLAGSMAGEHIQLPGGSFGYTRREPLGVCVG
IGAWNYPFQIACWKSAPALACGNAMIYKPSPFTPVSVLLLAEIYTAAGVPPGLFNVVQGG
AATGQLLCQHRDVAKVSFTGSVPTGSKIMEMAAKGIKPVTLELGGKSPLIIFSDCDMKNA
VNGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQKIKIGDPLLEDTRMGPLIN
RPHLERVLGFIQVAKEQGAKVLCGGDLYEPKDPKLKDGYYMRPCILTNCRDDMTCVKEEI
FGPVMSILSFDTEAEVVERANDTTYGLAAGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXFGRENGRVTIEYYSQLKTVCVEMGDVESTFK
Download sequence
Identical sequences ENSOPRP00000014537 ENSOPRP00000014537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]