SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014871 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014871
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 5.54e-167
Family Phosphoglycerate kinase 0.00000000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014871   Gene: ENSOPRG00000016289   Transcript: ENSOPRT00000016279
Sequence length 417
Comment pep:known_by_projection scaffold:pika:scaffold_41722:3891:5144:-1 gene:ENSOPRG00000016289 transcript:ENSOPRT00000016279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLSKKLTLDKVDVKGKRVIMRVDYNVPMKNKQITSNQRIKASIPSIKYCLDNGAKAVIL
MSHLGRPDGIPMPDKYSLEPVANELKSLLGKDVMFLKDCVGSEVEKACANPVSGSVILLE
NLRFHVEEEGKGQDASGKKLKAEPHEIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPQKASGFLMKKELEYFAKALENPERPFLAILGGAKVADKIQLIKNMLDKVNEMIIGGGM
AFTFLKVLHNMEIGASLFDEEGAKIVNDIMAKADKNGVKITFPVDFVTADKFDEKANVGK
ATVQSGIPSGWMALDCGPESNKKFAQIVAQAKLIVWNGPVGVFEWDSFANGTKALMDEIV
KATSKGCVTVIGGGDTATCCAKWDTEDKVSHVSTGGGASLELLEGKILPGVEALTNL
Download sequence
Identical sequences ENSOPRP00000014871 ENSOPRP00000014871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]