SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015052 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015052
Domain Number 1 Region: 43-86
Classification Level Classification E-value
Superfamily TNF receptor-like 1.88e-18
Family BAFF receptor-like 0.00044
Further Details:      
 
Domain Number 2 Region: 10-46
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000596
Family BAFF receptor-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015052   Gene: ENSOPRG00000016490   Transcript: ENSOPRT00000016484
Sequence length 270
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1716:66686:72512:1 gene:ENSOPRG00000016490 transcript:ENSOPRT00000016484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQGLWTGAAMRPCPEEQFWDPLLNTCVSCKPLCSQRSQRTCVAFCKSLSCRKEQGRYYDH
LLRDCISCTPICGQHPKQCEHFCENKFRSRGNLSPDLRRQQSGESEIRADGRYQGSEHSG
LEAAPAPPGSRLSAQQLALVYSTLGICLCAIICCFLLAVACFLRRRGDQFSCQSLAGRCR
PQTKWSHDLTTEAGAATSASPGPVDTCSFCFPERRAPTQESAGAPKTPGHVGAENQGHHS
GTRTLQLCVRAPDGGLGPVCSPAREGSPGA
Download sequence
Identical sequences ENSOPRP00000015052 ENSOPRP00000015052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]