SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015138 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015138
Domain Number 1 Region: 176-366
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 9.09e-37
Family Extradiol dioxygenases 0.000000277
Further Details:      
 
Domain Number 2 Region: 16-101
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 6.85e-22
Family Extradiol dioxygenases 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015138   Gene: ENSOPRG00000016575   Transcript: ENSOPRT00000016579
Sequence length 391
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4823:125198:130876:-1 gene:ENSOPRG00000016575 transcript:ENSOPRT00000016579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCTKMGFEPLAYRGLETGSRQVVSH
VIKQGQIMFVLSSALNPGNREMGEHLVTHGDGVKDIAFEVDCDYIVQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPHCSLETI
DHIVGNQPEHEMESASDWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPIN
EPAPGRKKSQIQXXXXXXXXXXXXXXXXXXXXXXXXIPHLRARGMEFLAVPATLYKQREN
LKSAKIRVKESIDVLEELKILVDYDEKGYLLQIFTKPMQDRPTLFLEVIQRHNHQGFGAG
NFNSLFKAFEEEQNLRGNLTDMEANGVTRGM
Download sequence
Identical sequences ENSOPRP00000015138 ENSOPRP00000015138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]