SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015275 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015275
Domain Number 1 Region: 72-143,188-443
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 5.49e-83
Family NadC C-terminal domain-like 0.0000338
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.000000000000275
Family NadC N-terminal domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015275   Gene: ENSOPRG00000016712   Transcript: ENSOPRT00000016724
Sequence length 483
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_925:13263:17618:-1 gene:ENSOPRG00000016712 transcript:ENSOPRT00000016724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQFLASKLPPDTDPAFFEHLRGLDCSRVTLRALPEGSLAFPGVPLLQVSGPLLVVQLLET
PLLCLVGYASLVATNAARLRLIAGPEKRLLELGLRRAQGPDGGLTASTYSYLGGFDGSSN
VLAGQLRGVPVAGTLAHSFITSFSGSEVPPEPILAPAVSEGPGNLTAHVKVLKKLCAHLG
WALQEPHLGSGATLSDYAMAFPQIFQGLLESYNVRRSGLPNFLAVALALGELGYRAVGLR
LDSGDLLQQAQEIRGILRSTAARFQMPWLERISITVSNNVDEEELARLVQEGSEVDGIGI
GTSVVTCPQQPSLGCVYKLVCVGGQPRMKLTEDPEKQTLPGKKAAFRLLDADGSPLLDLL
QLAEEPSPQPGQELRVWPRGAQEPRTVRPAQVELLLGLWVHRGQLCQPLPPLAESRAFAQ
RSLGHLRAAHRRLQSPEQNQVGGGQRDPGTTPQSHPAAPPSLQVALSEQLQALVGSLSPR
SSP
Download sequence
Identical sequences ENSOPRP00000015275 ENSOPRP00000015275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]