SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015341 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015341
Domain Number 1 Region: 17-628
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 8.5e-230
Family Aconitase iron-sulfur domain 2.52e-16
Further Details:      
 
Domain Number 2 Region: 633-751
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 6.47e-33
Family LeuD-like 0.000000572
Further Details:      
 
Domain Number 3 Region: 789-887
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 4.32e-24
Family LeuD-like 0.0000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015341   Gene: ENSOPRG00000016791   Transcript: ENSOPRT00000016799
Sequence length 889
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1649:81218:129702:1 gene:ENSOPRG00000016791 transcript:ENSOPRT00000016799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNPFAHLAEPLDPAQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAVRNCDKFLVKKEDI
ENILNWNVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPICPV
DLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFRNMRIIPPGSGIIHQV
NLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLP
QVIGYKLMGKPDPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMC
PEYGATAAFFPVDEVSMKYLVQTGRDESKVKHIRKYLQAVGMFRDFNDSSQDPDFTQVVE
LDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQIAPNRHNDQKTFIYNNS
EFTLSHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLNVKPYVKTSLSPGSGVVTY
YLRESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEG
RVHPNTRANYLASPPLVIAYAIAGTIRIDFAKEPLGTNAKGQQIFLKDIWPTREEIQAVE
QQYVIPGMFTEVYQKIETVNASWNALAAPSDKLYLWNPKSTYIKSPPFFENLTLDLQPPK
SIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMA
RGTFANIRLLNKFLNKQAPQTIHLPSGETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENAESLGLTGQERYTIIIP
ENLKPRMNVQVKLDTGKTFQAVMRFDTDVELTYFHNGGILNYMIRKMAK
Download sequence
Identical sequences ENSOPRP00000015341 ENSOPRP00000015341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]