SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015533 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015533
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 3.61e-51
Family Ran-binding protein mog1p 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015533   Gene: ENSOPRG00000017014   Transcript: ENSOPRT00000017012
Sequence length 172
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4400:271370:272445:1 gene:ENSOPRG00000017014 transcript:ENSOPRT00000017012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTRDYPLFGGAFSAILPPGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVCG
EAAARYHFEDVGGVQGARSQQVESVQSLGSESLALRSCCPEAWVLSGKQQVAKENQQVAK
DVAVHQALLRLPQYETDVLLTFNQPPTSDKRSSSPGKVSPPPNWGDFELVGT
Download sequence
Identical sequences ENSOPRP00000015533 ENSOPRP00000015533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]