SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000016323 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000016323
Domain Number 1 Region: 194-311
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.13e-27
Family YicI N-terminal domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 312-470
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.61e-19
Family YicI catalytic domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 63-97
Classification Level Classification E-value
Superfamily Trefoil 0.0000706
Family Trefoil 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000016323   Gene: ENSOPRG00000018558   Transcript: ENSOPRT00000018566
Sequence length 477
Comment pep:novel genescaffold:pika:GeneScaffold_4379:61813:80966:1 gene:ENSOPRG00000018558 transcript:ENSOPRT00000018566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKLSVLEILLITFTVIVGIVDILLGLFLLDIPSXXXXXXXXXXXXXXXXXXXXXXXXX
XXDTCRWKLKCCWKPEAAVDVPVCFFPRNWGYEVSGDITNTSTXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXLDTSIGPLQFAHQYLQLSFRLPSTNVYGLGEHVHQQYRHNMTWKTWPI
FTRNSDPVAGMINLYGAHTFFLCLEDTSGFSFGVFLMNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPSYWSLGFQLSRRDYGGIEGLREVVERTRKAEI
PYDVQYSDIDYMDGNKDFTINEIAYPGLSDFAKELHDNGQKYVIIMNPGIFISPNYTAYN
NGSLQRVWILDSHGFAVGECPDYSHSAWRTQSWTEQSTESYNTLEFDGVWIVSYYSR
Download sequence
Identical sequences ENSOPRP00000016323 ENSOPRP00000016323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]