SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000445 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000445
Domain Number 1 Region: 484-717
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 6.2e-50
Family FMN-linked oxidoreductases 0.00000000194
Further Details:      
 
Domain Number 2 Region: 870-962
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.68e-21
Family Ferredoxin domains from multidomain proteins 0.0000102
Further Details:      
 
Domain Number 3 Region: 269-389
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.81e-20
Family C-terminal domain of adrenodoxin reductase-like 0.0000027
Further Details:      
 
Domain Number 4 Region: 338-360,388-456
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000712
Family C-terminal domain of adrenodoxin reductase-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000445   Gene: ENSOPRG00000000478   Transcript: ENSOPRT00000000485
Sequence length 975
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4812:41139:733476:-1 gene:ENSOPRG00000000478 transcript:ENSOPRT00000000485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NCEKLENNFDDIKHTTLGERGALREAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASE
IPQFRLPYDVVNFEIELMKDLGVKIVCGKSLSVNEMTLCTLKEAGYKAAFIGIXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMCACHSPLPSIRGAVIVLGAGDTAFDCATS
ALRCGARRVFVVFRKGFVNIRAVPEEXXXXXXXKCEFLPFLSPRKVIVKGGRIVAMQFVR
TEQDETGQWREDEDQIVRLKADVVISAFGSVLSSPQVKEALSPIKFNRWGLPEVDPETMQ
TSEPWVFAGGDIVGVANTTVESVNDGKQASWYIHKYLQSQFGASVSAKPELPLFYTPIDL
VDISVEMAGLKFINPFGLASATPATSTSMIRRAFEAGWGFALTKTFSLDKXXXXXXXXXX
XXXXXXGPVYGPGRSSFLNIELISDKTAAYWCQSATELKAEFPHNIVIASIMCSYNKNDW
MELSKKAEASGADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQAVQIPFFAKL
TPNVTDIVSIARAAKEGGADGVTATNTVSGLMGLKADGTPWPAVGTGKRTTYGGVSXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVIGKALQYLGTYGELSNMEQVVALIDE
EMCINCGKCYMTCNDSGYQAIQFDPETHLPTVTDNCTGCTLCLSVCPIIDCIKMVSRTTP
YEPKRGLPLALSPAC
Download sequence
Identical sequences ENSOPRP00000000445 ENSOPRP00000000445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]