SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002020 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002020
Domain Number 1 Region: 148-278
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.04e-33
Family Insect phospholipase A2 0.0005
Further Details:      
 
Domain Number 2 Region: 363-456
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.00000000000000831
Family Insect phospholipase A2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002020   Gene: ENSOPRG00000002192   Transcript: ENSOPRT00000002189
Sequence length 502
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4625:318835:323551:-1 gene:ENSOPRG00000002192 transcript:ENSOPRT00000002189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPALLLGILSFLGVAPWGCPALWDSTSCHLAGLVPGSPLSSLSFLGKDAQGLALFQAR
WDARRRLQACSRQDEPELTAAYRTLCTHEATRDSFIHIPGPELQRALATLQQEACPGPED
SPAKARERRAILQAGAQASRYPRVKRGWTVPGTLWCGVGDSAGNSSKLGIFQGPDLCCQE
HDRCPLNITPLQYQYGIRNFRFHTISHCDCDTRFQQCLRNQGDSISDLVGVAFFNVLEIP
CFVLEEREACVEWYWWGGCRTYGLVPHARLQPRTHYNASWSSTATSLPPNPQSPAPTKPT
LKQQRLRKWWWRHKASRRLSTANVTALQTSMASPVPGLDPTGLQSSRGELKRQGAHQACR
GFRHLDQCEFQIGSQETKFRLLNTARRPLFHCDCTRRLARFLRLHGPPAGTDMLWEQLGT
TCFKLALPLDCTVSEGCSKDPRAIEVSAQHLWRLFRQRRRELQDQDMDEGQHPGPSMPFY
DQCLRLSQAANSPNRQKMFNQS
Download sequence
Identical sequences ENSOPRP00000002020 ENSOPRP00000002020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]