SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002310 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002310
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000000445
Family Transducin (heterotrimeric G protein), gamma chain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002310   Gene: ENSOPRG00000002522   Transcript: ENSOPRT00000002503
Sequence length 42
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1434:288200:288328:-1 gene:ENSOPRG00000002522 transcript:ENSOPRT00000002503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSQAAADLMAYCEAHVREDPLISPVPASENPFREKKFFCVIL
Download sequence
Identical sequences ENSOPRP00000002310 ENSOPRP00000002310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]