SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004875 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004875
Domain Number 1 Region: 277-375
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.19e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0005
Further Details:      
 
Domain Number 2 Region: 31-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004875   Gene: ENSOPRG00000005292   Transcript: ENSOPRT00000005306
Sequence length 847
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1849:7383:54521:-1 gene:ENSOPRG00000005292 transcript:ENSOPRT00000005306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLFTISCSKMSSSIDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPAFLSNEEFTQLMLEXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLSSVSTSAHNGLEGTIQHT
HRPSYEERICFVATVRLATPQFIKEMCTVEEPNEETARHSLEWKFLFLDHRAPPIIGYLP
FEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQ
WNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEAL
ERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPAGGSTPPRQRVPGHEKAARGRPSFS
SQSMNSQSIGPSLTQPVMCQPAHLAVPQGMSQFQFSAQLGAMQHLKDQLEQRTRIIEANI
HRQQEELRKIQEQLQLVHGQGLQMFLQQSNPGLNLGSVQLPSGTSSNIQQLAPVNMQGPV
VPAGQTQSGMTPGHTGTSQHLLAQPTLQNTSGQSQPGVLSGHSQQASLPSQTQSTLPAPL
YNTMVISQPAAGSVVQIPSSVPQSSARSATVSTVTQDRQIRFSQGQQLVTKLVTAPVACG
AVMVPSTMLMGQVVTAYPALAAQQQPPQALSALQTQPPPPGSQEQPLPAVQQASPAQLTQ
PPQPPQPFLQTSRLLHGSPSAQLILSAAFPLQPSTFSSAHHQQHQSQQQLGRHRTDSLSD
PSKAQPQ
Download sequence
Identical sequences ENSOPRP00000004875 ENSOPRP00000004875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]