SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005547 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005547
Domain Number 1 Region: 53-501
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.75e-123
Family Pyridoxal-dependent decarboxylase 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005547   Gene: ENSOPRG00000006041   Transcript: ENSOPRT00000006043
Sequence length 502
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2476:43098:59759:-1 gene:ENSOPRG00000006041 transcript:ENSOPRT00000006043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLCALIPAILMAESKPLPCADGDPMAVEALLRDVFAIVXXXXXXXXXXXXXXVCEWKEP
GELKQLLDLELRGQGESREQLLERCRTVIRYSVKTGHPRFFNQLFSGLDPHSLAGRIITE
SINTSXXXXXXXPVFVLMEELGKLRALVGWTPGDGVFCPGGSISNMYAVNLARYQRYPEC
KQRGLRALPPLALFTSAECHYSISKGAAFLGLGTDNVRTVKADDRGKMIPEDLERQILLA
KAEGAVPFLVNATCGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSRTHRHLLE
GIHRADSVAWNPHKLLGAGLQCSALLLRDTSNMLKRCHGSQASYLFQQDKFYDVALDTGD
KVVQCGRRVDCLKLWLMWKAQGDQGLELRVDRAFTLARYLVEEVKKREGFELIMEPEFLN
VCFWFVPLSLRGQQGSPDYDQRLAKVAPILKERMVKAGSMMIGYQPHGGQANFFRVIVAN
PALTRTDLDFLLDELQRLGSDL
Download sequence
Identical sequences ENSOPRP00000005547 ENSOPRP00000005547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]