SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005903 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005903
Domain Number 1 Region: 4-67
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.31e-22
Family Transducin (heterotrimeric G protein), gamma chain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005903   Gene: ENSOPRG00000006444   Transcript: ENSOPRT00000006439
Sequence length 72
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_515:411530:413331:-1 gene:ENSOPRG00000006444 transcript:ENSOPRT00000006439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
Download sequence
Identical sequences A0A0D9S711 A0A2I2YIX9 A0A2I3M756 A0A2J8WPT7 A0A2K5EXW0 A0A2K5J603 A0A2K5KQU2 A0A2K5S5Z1 A0A2K5ZMK7 A0A2K6E622 A0A2K6EH85 A0A2K6M4U8 A0A2K6RMD8 A0A2K6T0V3 F7E106 G1TUD2 G7NWY8 H2QZN8 I0FMD9 Q5RBQ0 Q9UBI6
ENSPPYP00000001459 ENSMMUP00000019435 ENSPTRP00000039260 ENSCHOP00000012121 ENSPTRP00000039260 ENSP00000360021 ENSCJAP00000032253 ENSOCUP00000020657 ENSPANP00000004998 9361.ENSDNOP00000013002 9544.ENSMMUP00000019435 9598.ENSPTRP00000039260 9600.ENSPPYP00000001459 9606.ENSP00000360021 9986.ENSOCUP00000020657 gi|51036603|ref|NP_061329.3| ENSP00000360021 ENSGGOP00000015928 ENSOPRP00000005903 ENSDNOP00000033787 ENSMMUP00000019435 ENSOPRP00000005903 ENSP00000360021 HR6474 ENSGGOP00000015928 NP_001126086.1.23681 NP_001248684.1.72884 NP_061329.3.87134 NP_061329.3.92137 XP_002750986.1.60252 XP_003308182.1.37143 XP_003308183.1.37143 XP_003921483.1.74449 XP_004025997.1.27298 XP_004025998.1.27298 XP_004588817.1.84141 XP_005543126.1.63531 XP_005543128.1.63531 XP_006167215.1.99106 XP_006167216.1.99106 XP_006167217.1.99106 XP_007976536.1.81039 XP_007976537.1.81039 XP_007976538.1.81039 XP_007976540.1.81039 XP_007976541.1.81039 XP_008842834.1.79516 XP_008842836.1.79516 XP_008999710.1.60252 XP_009247387.1.23681 XP_009247391.1.23681 XP_009247396.1.23681 XP_009458711.1.37143 XP_010346140.1.74449 XP_010355370.1.97406 XP_010355371.1.97406 XP_011768805.1.29376 XP_011768806.1.29376 XP_011768807.1.29376 XP_011768808.1.29376 XP_011768809.1.29376 XP_011792272.1.43180 XP_011792273.1.43180 XP_011792274.1.43180 XP_011850384.1.47321 XP_011850385.1.47321 XP_011850386.1.47321 XP_011937682.1.92194 XP_011937683.1.92194 XP_011937685.1.92194 XP_011937686.1.92194 XP_012298108.1.9421 XP_012298109.1.9421 XP_012298110.1.9421 XP_014996791.1.72884 XP_014996798.1.72884 XP_014996804.1.72884 XP_014996810.1.72884 XP_014996815.1.72884 XP_015289793.1.63531 XP_016857298.1.92137 XP_016857299.1.92137 XP_016857300.1.92137 XP_017201671.1.1745 XP_017201672.1.1745 XP_017201673.1.1745 XP_017201674.1.1745 XP_017201675.1.1745 XP_017201676.1.1745 XP_017201677.1.1745 XP_017201678.1.1745 XP_017201679.1.1745 XP_017201680.1.1745 XP_017387738.1.71028 XP_017387747.1.71028 XP_017656503.1.79516 XP_017732635.1.44346 XP_017732636.1.44346 XP_018875123.1.27298 XP_018875130.1.27298 XP_018875139.1.27298 XP_020144415.1.48125 XP_020144416.1.48125 ENSDNOP00000013002 ENSPPYP00000001459 ENSCHOP00000012121 ENSOCUP00000020657 ENSCJAP00000032253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]