SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007747 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007747
Domain Number 1 Region: 300-436
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-30
Family SH2 domain 0.00000118
Further Details:      
 
Domain Number 2 Region: 608-710
Classification Level Classification E-value
Superfamily SH2 domain 7.27e-23
Family SH2 domain 0.00000281
Further Details:      
 
Domain Number 3 Region: 4-83
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-17
Family SH3-domain 0.00000511
Further Details:      
 
Domain Number 4 Region: 208-295
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000000000804
Family BCR-homology GTPase activation domain (BH-domain) 0.0000295
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000007747
Domain Number - Region: 117-168
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000687
Family BCR-homology GTPase activation domain (BH-domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000007747   Gene: ENSOPRG00000008453   Transcript: ENSOPRT00000008463
Sequence length 713
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2755:23172:110033:1 gene:ENSOPRG00000008453 transcript:ENSOPRT00000008463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGYQYRALYDYQKERDEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKPEADTEHPASTLPDLTE
QFAPPDVAPPLLGKLVEAIEKKGLECATLYRTQSSSSPAEIRQLLDGXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXSEMVSLAQEIQSPGDYMQVLKKLIRSPGIPPQHWLTL
QHLLKHFFKLSQASSKNLLSARVLAEIFSPMLFRFPAASPENTEHFVKAIEILISTENER
QPVPALPPKPPKPTPVVNNGMNNSMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDAS
TKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLD
VKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKR
TAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDS
RRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNE
NTEDDEDLPHHDEKTWNGSSNRNKAENLLRGRDTFLDRESSKQGCYSCSVVVDGEVKHCV
INKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR
Download sequence
Identical sequences ENSOPRP00000007747 ENSOPRP00000007747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]