SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008147 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008147
Domain Number 1 Region: 64-107
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000458
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008147   Gene: ENSOPRG00000008916   Transcript: ENSOPRT00000008898
Sequence length 151
Comment pep:novel scaffold:pika:scaffold_178417:228:832:1 gene:ENSOPRG00000008916 transcript:ENSOPRT00000008898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVASGSAVATAGPSCALKAGKTAGGAGEVVRCLSEQSVAISRCAGTRLPALLDEQQVNV
LLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSEAEVGTPGGRGLP
GRAPLSTLNGEISSLTAEAACVPADDRILCR
Download sequence
Identical sequences ENSOPRP00000004267 ENSOPRP00000008147 XP_004585760.1.84141 ENSOPRP00000004267 ENSOPRP00000008147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]