SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009045 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009045
Domain Number 1 Region: 493-816
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.01e-105
Family Ankyrin repeat 0.00000000342
Further Details:      
 
Domain Number 2 Region: 231-392
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.37e-46
Family Ankyrin repeat 0.0000527
Further Details:      
 
Domain Number 3 Region: 3553-3635
Classification Level Classification E-value
Superfamily DEATH domain 6.39e-24
Family DEATH domain, DD 0.008
Further Details:      
 
Domain Number 4 Region: 32-63,97-158
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-23
Family Ankyrin repeat 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009045   Gene: ENSOPRG00000009831   Transcript: ENSOPRT00000009899
Sequence length 3858
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2742:101698:552840:1 gene:ENSOPRG00000009831 transcript:ENSOPRT00000009899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNEDAAQKSDSGEKFNGTSLRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTC
NQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNTALHIASLAGQAEVVKVLVKEG
ANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMMVNRTTESGTPLHIAA
HYANVNVTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTP
LHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVT
LDYLTALHVAAHCGHYRVTKLLLDKRANPNARALXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXEEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQ
VDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHV
AAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQG
VTPLHLASQEGHTDMVTLLLNKGANIHMSTKSGLTSLHLAAQEDKVNVAEILTKQGADKD
AHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQ
HGAKPNATTANGNTALAAKRLGYISVVDTLKVVTEEITTTTTXXXXXXXXXXXXXXXXXX
XXXXXXXDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMYLRYSEGGRSDSLRSFSSD
RSHTLSHASYLRDSAMIDDTVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIH
SGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEG
LASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFA
ALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITR
DFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSEL
VKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSIT
GGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVAFASQVYREIICVP
YMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDC
FGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAI
CNLNITLPVYTKXXXXXXXXXXXIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLS
EVSEMKQDLIKMTAILTTDVSDKAGSIKVKELAKAAEEEPGEPFEIVERVKEDLEKVNAI
LRSGTCTRDESHMQGSQSERELVEEDWVIVSAEEIQEAKQKAPVEITEYPCVEVRLEKEP
KVKTEKDPTGLVKYLTEDLNSYESPHKETPQIQTTQDTSGEQKEAPCTTRASASRGKDAP
SEEIQATQKQHKPSLGIKKPVRRKLKEKEKQKQKEEGLPDKATEKTELKKGSSEESLDED
PGLAPEPLPTEKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDLPKK
TTTRTHPTVSPSLKSERHPPASPSSKTERHSSLSSSAKPERHTPLSPSNKTEKHSPVSPS
PKTERHSPVSSSGKTEKHSPVSPSTKTERHSPVSSAKPERHTPVSPAGKADKRPPVLSSG
RTEKHPPVSPGRTEKRLPVSPSGRTEKHPTTGKTEKHLPVSPGKTEKQPPVSPTSKTERI
EETMSVRELMKAFQSGQDPSKHKTGLFEHKVAKQKQPQEKGKNRVEKEKGHTTNTRELQK
TESQTIKRGQRFLVIGTSEPKRGIRASTIGFKKEDAVGEKEKALGPKTDEVVQSTPEEES
HRDSDIPKEKMADEQGDLDLQISPDRKTSTDFSDVIKQELENNDKYQEFCLSAETTEKVQ
LHLDQVLTSPFNTTFPLDYMKGEFLPALSLQSSALPGSSESLKHEGIVGSPCGSLMEGTP
QISSEESYKHEGLAETPETSPESLSFSPKRSEEQIGEAKEITQLETPTEIHSEKEHPTTK
DVTVDPEGPNSMVAESSGPSPEYLRETATLDPSTDTCSKPENDYPGSSSVTIASQIPKSS
HDANQLTCGDSAHHKTQTDIETQESSTPCNERKAPPDASAKADTETESKPPGVIRSPQGL
ELPLPSRDSEVLSPMADESLVVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSL
ESSPVEPKMKAGVLPSHFPLPAAVAKTELLSEVASMRSRLLRDPDGSAEDDSLEQTSLME
SSGKSPLSPDTPSSEEVSYEVTPKTTETSTPKPAVIHECSEEDDSENGEKKRFTPEEEMF
KMVTKIKMFDELEQEAKQKRDCRKETKQEESPSASDPDADCSADGNEPKYVDSVDGKSDV
PLLVTSESRKISSSSESEPELTQLEKGADSGLLQEPVIRVQPPSPLPSSIDSSSSPEEIQ
FQPIAAKQYTFKMNDDTQEESHTSEKEKDCETHLAKDNHKISTIDTDRPDDDLNRVADQP
KICDGHGCEAVSPSSSGTPASSALQSVTSADVEEQLALQKEALALSDTDKKDTGEKEVEA
SVVDSPRADCPRESSPSLSSLPQCLGSEGKDCGVDLSSTSSTTKEEVIKTDQAFQSLSKD
CSALDSSMAMQTEGFSMNSPMSDLAETDETYDPQVISPYENVPPQSFFSNDESKLQMQSS
HTTSSHSSEVYSVTITSSINEVTVESTCTRTVSGQESNNESQKIEMESKQDSTMWEMQSE
TTLSSSEPSVLNATVISGEKISQVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGL
MVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESF
HFFQIGQESGEEVLSEDVKIGAAAVGPSQVEITAESPALSESKEMGDDEADLVPDDLSEE
SEDTPASDTQLSSQVGISASTEMSREEDISTGTKDLPAMQMETALPVSSCPDAPEPGAQV
QLDFSTVIRSVHSGRDDDSPDSSPEEQKSVIEIPTASMENVPSAESKSKIPVRTIPTSIP
ALPSAENENSLSEEFLSSLDEENKEDEIKPKSKIPIKASVQRAEQQLSQPDLTLQKTEDS
AASQGQDTARKTPVDGSKSESDDSPLDSNTRCPVKHTGDTETEVETRERAEELESEEGGT
TPKIFSSRLPVKNRSSTSSSSGGLSPTKESREHFFDLYRNSIEFFEEISDEASKLVDRLT
QSEREQEVVSDDESSSALEVSVIENLPPVETENSVPEDIFDTRPIWDESIETLIERIPDE
NGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFSEEQIHQIRIENPNSLQDQS
HALLKYWLERDGKHATDTILIECLTKINRMDIVHLXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXFSVLQEELCTAQHKQKEEQAVSKESESCDQPPIVSEEDISVGYSTLQDCIPRTEG
DTALSPTQKEQLHQDFGKTQDLPEESSLYQQEYESGDEPQTVRTLDAPFKSGDDMPDLPP
ETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSDGTEKEEITVQGVPQEPVDITEEDAYSKV
IKRVILKSDIQQSEDNAE
Download sequence
Identical sequences ENSOPRP00000009045 ENSOPRP00000009045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]