SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009464 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009464
Domain Number 1 Region: 266-363
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000209
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0033
Further Details:      
 
Domain Number 2 Region: 15-57
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000746
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000009464
Domain Number - Region: 127-155
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0471
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009464   Gene: ENSOPRG00000010358   Transcript: ENSOPRT00000010360
Sequence length 822
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1044:48002:80669:1 gene:ENSOPRG00000010358 transcript:ENSOPRT00000010360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKLIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVISKLDKLSVLRLSVSYLRASFF
DVALKSSPVDRNGGQDNCRPNFGEGLNLQEGEFLLQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXSDVIHQSVYELIHTEDRAEFQRQLHWALNPSSGADPGQGADETHALAQPVYYSP
EQLPPENSSFMERCFICRLRCLLDNSSGFLAMNFQGRLKYLHGQNKKGKDGSVLPPQLAL
FAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGCDAKGQIVLGYTEAELCMRGSGYQFV
HAADMLYCAESHVRMIKTGEGCLAVFRLLAKDNRWVWVQSNARFIYKNGRPDFIIATQRP
LTDEEGREHLRKRNLKLPFMFATGEAVLYEVTNPFPPIMDPLPIRTQSGAGGKDPATKLT
PSKDSLNPSSLLCALMQQDESYLPSSSAPFESFFTDSLSECRNWQGGSITSVASGSGSVL
KHEQVGQSQEANHAFSGGPPGLLPDNKNSELYDIMRSLGVDFEDFKHMQNEEFFSTDLPA
EVDFRDIDITDEILTFVQESLNKSPLVSPGYQPPAAAALNSSCMVQGHLQLGQPPQPPCP
PEQVVVEPQQQLCQRMEHMQVNSVFANWGANQPLPLTCPQRVLQSYDIFTDSHTADQTFP
YTSEVDAVPYTQNLIPCEQAAPPQHKQAQLALPMGSFDSSSYPSTSNIEDFVTCLHAPDG
HLGGMNPQSAMVTPQACYAGAVSMYQCQPGPAHTLVGQMQCDPPVPGPPAFLNNFQNGGV
LNETYPAELHDVNNTMSNTHLPPLHHPAEARPFPDLTSSGLL
Download sequence
Identical sequences ENSOPRP00000009464 ENSOPRP00000009464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]