SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009500 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009500
Domain Number 1 Region: 449-524
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.1e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0074
Further Details:      
 
Domain Number 2 Region: 238-292,319-334,362-380
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.23e-16
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 156-239
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000301
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 616-792
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.00000483
Family Tetraviridae-like VP 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009500   Gene: ENSOPRG00000010374   Transcript: ENSOPRT00000010399
Sequence length 847
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2640:523633:654879:-1 gene:ENSOPRG00000010374 transcript:ENSOPRT00000010399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDSAVTVAAGGRRFWGVALPSPAPRDRWRRRLLPGGGWRGGGGGIQGHGGDHCPGXXXXX
XXXXXXXXXXXXXXMTSDVPSLGAAIASGNPGPGIQGGAAIVQRAIKRRPGLDFDDDGEG
NSKFLXXXXXXXXXXXXXXXXSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDM
VPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGF
LFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGR
ILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNSAVDPVSMNRLSFVRNRCRNGLGS
VKDGEPHFVVVHCTGYIKAWPPADDDPEAGQGSKFCLVAIGRLQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNREWLWTRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNPIQ
RPQLGPTALPLECSGQLAPRQQQQQAELDMVPGRDGLTSYNHSQISVQPVTTTGPEHSKP
LEKSDSLFAQDRDPRYSEIYSNITADQSKAISSSTVPASQQLFSQGNTFPPNPRPAENFR
NSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGTAPNWSPSTRGFSAQQVASQAATKTRS
TQFGVGNFQSPSSFNSMSLSSASTASSGAAGYPSLTSRGSNFAPETGQPAGQFPTRTAEG
VGVWPQWQGQQPHHRSSSGEQHVQQPSAQQASQPEVFQEMLSMLGDQSNNYNNEEFPDLT
MFPSFSE
Download sequence
Identical sequences ENSOPRP00000009500 ENSOPRP00000009500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]