SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010767 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010767
Domain Number 1 Region: 622-1147
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.14e-145
Family alpha-mannosidase, C-terminal domain 0.00000148
Further Details:      
 
Domain Number 2 Region: 124-499
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4e-139
Family alpha-mannosidase 0.00000000103
Further Details:      
 
Domain Number 3 Region: 502-616
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 2.45e-29
Family alpha-mannosidase, domain 2 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010767   Gene: ENSOPRG00000011776   Transcript: ENSOPRT00000011799
Sequence length 1149
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2270:145215:158115:1 gene:ENSOPRG00000011776 transcript:ENSOPRT00000011799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPARHHSGGNFPRSQISVLQNRIQQLEQL
LEENPEIIRHIKDSVLELTANAEGPPALLPYYTDNGSWVLPPEPRPSFFSVSPQDCQFAL
GGRGQKPELQMLTVSEMLPFDNVEGGVWRQGFDISYSPHDWDAEDLQVFVVPHSHNDPGW
IKTFDKYYMEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNISAQKKAAVRRLVGN
GQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGAVPRSGWAVDPFGYSSTMPYL
LRRANVTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDIPHTC
GPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAAVLLDQYRKKSRLFRSNVLL
VPLGDDFRYDKPQEWDAQFFNYQRLFDFLNSKPDLHVQAQFGTLSDYFDALYKRSGVEPG
ARPPGFPVLSGDFFSYADREDHYWTGYFTSRPFYKSLDRVLEAHLRGAEIMYSLAVTHAR
RAGLATQYPLSDFALLTEARRALGLFQHHDAITGTAKEAVVVDYGVRLLRSLVGLKRVII
NAAHYLVLGDKSTYHFDPEVPFLQADDTRVNHDALPERTVIPLDPSPRFVVLFNPLEHER
LSVVSLLVNSPRVRVFSEEGQPLAVQISPHWSSATDMVPDVYQVSLPVRVPALGLGVLQL
QQGLDRLRTLPSSVRVYLQGRRLTVSRHEAFPMRVIDTGASDFALSTHYMQVWFSGLTGL
LKSIRRVDEEQEHRVDMQFLIYGTRTSKDKSGAYLFLPDGEAQPYIPKEPPVVRVLEGPF
FSEVVAYYEHMHQVVRLYNVPGVEGLSLDMASLVDIRDYVNKELALRLHTDVDSQGTFFT
DLNGFQVQPRRYLKKLPLQANFYPMPVMAYIQDPQERLTLHTAQALGVSSLGNGQLEVIL
DRRLMQDDNRGLGQGLKDNKRTWNHFRLLLERRTAGPSPSEVQESYPSLLSHLTSVHLNT
PVLALPVVKRQSPDPGLRPFHPLAVSLPCDFHLLNLRSLPAEEDTLPSLDTALILHRKGF
DCGLEAKNLGFNCSTSQGKVALGSLFRGLDVGFLQPTSLTLLYPLASPSNSTDIYMEPME
VATFRLRLV
Download sequence
Identical sequences ENSOPRP00000010767 ENSOPRP00000010767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]