SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011369 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011369
Domain Number 1 Region: 110-592
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.53e-103
Family Pyridoxal-dependent decarboxylase 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011369   Gene: ENSOPRG00000012452   Transcript: ENSOPRT00000012452
Sequence length 593
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_379:746730:790775:1 gene:ENSOPRG00000012452 transcript:ENSOPRT00000012452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSTPSSSATSSNAGADPNTANLRPTTYDTWSRVAHGCTRKGLKICGFLQRTNSLEEKS
RLVSAFRERQSSKNLLSCENSEREARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVV
DILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVR
TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTYEIAPVFVLMEQITLKKMREIVGWSS
KDGDGIFSPGGAISNLYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAAL
GFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIAD
LCEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVREK
GLLQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAPK
IKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
Download sequence
Identical sequences ENSOPRP00000011369 ENSOPRP00000011369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]