SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011575 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011575
Domain Number 1 Region: 206-514
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.45e-94
Family Pyridoxal-dependent decarboxylase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011575   Gene: ENSOPRG00000012672   Transcript: ENSOPRT00000012674
Sequence length 568
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1085:202630:252326:1 gene:ENSOPRG00000012672 transcript:ENSOPRT00000012674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSDLLTLKAFEPYFEILEAYSIKAKNYVNGHCTKYEPWQLIAWSVLWTLLVVWLYDFI
FQPEXXXXXXXXXXXXXXXXXXXXXXXIEDKLNKTKDDISKHLSFLKVNKEYVKALPSQG
LSPSAVLEKLKEYSSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXVTSGGTESILMACKAYRDLAREKGIKTPEIVAPVS
AHAAFDKAANYFGMKIVRVPLNKMMEVDVRAMRRAISKNTAMLVCSAPQFGHGTIDPIPE
VAKLAVKYKVPLHVDACLGGFLIVFMEKAGYPLDRPFDFRVEGVTSISADTHKYGYAPKG
SSVVLYSEKKYRNYQFFVSTDWQGGIYASPSIAGSRPGGISAACWAALMYFGENGYVEST
KQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSREFDIFRLSNLMTAKGWNLNQLQFP
PSIHFCITLVHTRKRVATQFLKDVRESVTQIMKNPKAKTTGMGAIYGNAQAIIDRNLVAE
LTSVFLNSLYSTDTIAQGPQMNGAPEPR
Download sequence
Identical sequences ENSOPRP00000011575 ENSOPRP00000011575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]