SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011797 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011797
Domain Number 1 Region: 500-635,692-758
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.89e-40
Family Hemopexin-like domain 0.00062
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000968
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000549
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011797   Gene: ENSOPRG00000012911   Transcript: ENSOPRT00000012919
Sequence length 758
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2636:589105:641007:1 gene:ENSOPRG00000012911 transcript:ENSOPRT00000012919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWRLLPAGLLLLCSAVLIPQASSKDLSSCAGRCGEGYSRDAICNCDYNCQHYTECCPDF
KKVCTVELSCKGRCFESFARGRECDCDAQCKTYGKCCSDYEEFCQEVHNPTSPPTSKPAP
LPPGAPQSIKSTTKRSPKSPNKKKTKKVIESEEITEEHSVSENQESSSSSSSSSTIRKVK
SSKNSAANRELQKKPKVKDNKMKTTRKKPSSKPPAADDTGSGLDSGDPKPTPTPDVSTTA
RSKVTSPPKATTVKPANPKPSSPPHPDKSKEKPPKTNKETTAETKTTETNKQMSTSAKEK
TTSVKETRTADKTPAKDSTPAPKLPAKPTPKAETTTKAPVLTTPKEPAATTPKEAAPTTA
KQAAPTTPKEAAPTTPKEPAPTTTKEPAPTTTKETAPTTTKEPAPTTPKQSAPTTTKEPA
PITTKEPAPTTPEPAPTTPKEPALTTPKEPLLTTHKKTASATKVSAPTTLGPVPTKPKFI
PPIAKGSPTSPKAPSPIETNLCNGKPVDGLTTLRNGTLVAFRGHYFWMLNPFQPPSPPRR
ITDVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDVRDAGYPKPIAKGFGGLTGKIV
AALSIAKYKNRPESVYFFKRGGNIQQYTYKQEPVRKCPGRFPINYSVYGETAQVRRRRFE
RALGPQMQTIRIQYSPVRLSYQDKGFLHNEVKVSTIWSGLPGLVTSAISLPNARKPDGYD
YYAFSKDQYYNIDVPTRTARAITTRSGQTLSKIWYNCP
Download sequence
Identical sequences ENSOPRP00000011797 ENSOPRP00000011797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]