SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012017 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012017
Domain Number 1 Region: 230-334
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.5e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 5-53
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000353
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000012017
Domain Number - Region: 118-194
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00107
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012017   Gene: ENSOPRG00000013168   Transcript: ENSOPRT00000013166
Sequence length 765
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1245:75667:158001:-1 gene:ENSOPRG00000013168 transcript:ENSOPRT00000013166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEGL
GEAWGHSSRTSPLDNVGRELGSHLLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVELT
GNSIYEYIHPADHDEMTAVLTAHQPYHSHFVQEYEIERSFFLRMKCVLAKRNAGLTCGGY
KVIHCSGYLKIRQYSLDMSPFDGCYQNVGLVAVGHSLPPSAVTEIKLHSNMFMFRASLDM
KLIFLDSRVAELTGYEPQDLIEKTLYHHVHGCDTFHLRCAHHLLLVKGQVTTKYYRFLAK
HGGWVWVQSYATIVHNSRSSRPHCIVSVNYVLTDTEYKGLQLSLDQISASKPAFSYASSS
TPTLTDNRKGAKSRLSSSSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDSASPQLLD
PGDRPGSQHDVSCAYRQLSDRSSLCYSFALDPSRLVEERHFHTQACEGGRCEAGRYFLGT
PQPGREPWWSSRAALPLTKASPESRDVYENSMPHITSVHRLHGRGHWDEDSVVSSPDPGS
ASESGDRYRTEQYQNSPHEPSKIETLIRATQQMIKEEENRLQLRKAPPDQLASINGAGKK
HSPCFANYQQPLPTGEVCHSSALANTSPCDHIQQREGKMLSPHENDYDNSPTALSRISSP
NSDRVSKSSLILAKDYLHSDMSPHQTAGDHPAISPNCFGSHRQYFDKHAYTLTGYALEHL
YDTETIRNYSLGCNGSHFDVTSHLRMQPDPAQGHKGTSVIITNGS
Download sequence
Identical sequences ENSOPRP00000012017 ENSOPRP00000012017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]