SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012413 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012413
Domain Number 1 Region: 932-1135
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000458
Family WD40-repeat 0.026
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000012413
Domain Number - Region: 463-516
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00222
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012413   Gene: ENSOPRG00000013577   Transcript: ENSOPRT00000013604
Sequence length 1281
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1127:804252:982645:-1 gene:ENSOPRG00000013577 transcript:ENSOPRT00000013604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEDGVVYQEEPGGSGAVMSERVFRLAGSIYREFERLIGRYDEEVVKELMPLVVAVLEN
LDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRNHAEESRLEEREAELKKEYNALHQ
RHTEMIHNYMEHLERTKLHQLAGSDQLESAAHSRIRKERPISLGLFPLPAGDGLLTPDAQ
KGRETPGSEQWKFQELSQPRSHTSLKVSNSPEPLRAVEQLDELSDVSQSGSKATTPASTA
NSDVATIPTDTPLKEDNEAFVKVTDTANKSEISKHIEVQVAQETRNVSTGSVENEEKSEV
QAIIESTPELDMDKELSGYKGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEGA
DLLGMGREVENLILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLK
LEEKNKELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKER
LMELQEAVRWTEMIRASRENPAMQEKKRSSIWQFFSRLFSSSSNTTKKPEPPVNLKYNAP
TSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYRQVKAHVQKEDG
RVQAFGWSLPQKYKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXSASQSSLDKLDQELKEQQKELKNQEELSSQVWI
CTSTHSATKVIIIDAIQPGNILDSFTVCNSHVLCIASVPGARETDYPAGEELSESGQVDK
ASLCGSMTSNSSAETDSLLGGIAVVGCSTESATGAAASPSPSRASPVVEKAPXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNG
SDGCKDQISVLQNEQDLVREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLK
DSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRCMTVVHDKV
WCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTY
QHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSG
APGNRPGSVIRVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQ
SGSSGTDLTGDKAGPPAQEPGSQTPLKSMLVISGGEGYIDFRMGDEGGESELLGEDLPLE
PSVTRAERSHLIVWQVMYGSE
Download sequence
Identical sequences ENSOPRP00000012413 ENSOPRP00000012413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]