SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012487 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012487
Domain Number 1 Region: 144-227
Classification Level Classification E-value
Superfamily E set domains 4.3e-20
Family E-set domains of sugar-utilizing enzymes 0.09
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000012487
Domain Number - Region: 234-284
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00801
Family HLH, helix-loop-helix DNA-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012487   Gene: ENSOPRG00000013685   Transcript: ENSOPRT00000013688
Sequence length 476
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1098:22783:117994:-1 gene:ENSOPRG00000013685 transcript:ENSOPRT00000013688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSD
PVIIDRFFLKLSXXXXXXXXXXXXXXXXXXXXXVVVSTTVNVDGHVLAVSDNMFVHNNSK
HGRRARRLDPSEGTAPSYLDNATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTM
LVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQR
LQKVIPRHPGDPERLPKEVLLKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNH
NQIPALGNTPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ
QSNYNTVSTSMNGYGSGAMANLGVPGSPGFLNGSSANSPYGIVPSSPTMAASSVTLPSNC
SSTHGFSFSPANVISAVKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSGLVVPPM
Download sequence
Identical sequences ENSOPRP00000012487 ENSOPRP00000012487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]