SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012775 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012775
Domain Number 1 Region: 7-50
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000863
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00015
Further Details:      
 
Domain Number 2 Region: 340-375
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.000000000000136
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012775   Gene: ENSOPRG00000013994   Transcript: ENSOPRT00000013996
Sequence length 375
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3668:25342:61954:-1 gene:ENSOPRG00000013994 transcript:ENSOPRT00000013996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FATSAKTKTPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHS
EEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPTSQQATAPQVIVP
DSKLIQHMNASNMXXXXXXXXXXXXXXXXXXXXXXXXXXQLLQVVRAANGAQYIFQPQQS
VVLQQQVIPQMQPGGVQAPVIQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSEEDEDEEEDYDDDEEEDKEK
DGAEDGQVEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHRSKNKWKFHLKDGIMNLN
GRDYIFSKAIGDAEW
Download sequence
Identical sequences ENSOPRP00000012775 ENSOPRP00000012775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]