SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013592 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013592
Domain Number 1 Region: 433-792
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.56e-124
Family Ankyrin repeat 0.00000000051
Further Details:      
 
Domain Number 2 Region: 181-451
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.28e-75
Family Ankyrin repeat 0.00000206
Further Details:      
 
Domain Number 3 Region: 46-228
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.03e-43
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 4 Region: 4088-4198
Classification Level Classification E-value
Superfamily DEATH domain 1.18e-25
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013592   Gene: ENSOPRG00000014819   Transcript: ENSOPRT00000014884
Sequence length 4378
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3671:434548:732666:-1 gene:ENSOPRG00000014819 transcript:ENSOPRT00000014884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAASQLKKNRDLEINAEEETEKKKKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVL
QQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHI
AAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDG
LTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVD
DVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLK
HGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEV
VRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAR
EGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTP
LHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAQKNQMDIATTLLEYGADANAVT
RQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKNGLTPLHLAAQEDRVNVAEVLVNQGA
NVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINV
LLQNNASPNELTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIIEHKMNVPETMNE
VLDMSDDEVRKANAPEMLSDGEYISDIEEGEDAMTGDTDKYLGPQDLKELGDDSLPVEGY
MGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRH
YSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITC
RLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVGIPHFGPMRGKERELIVLRS
ENGETWKEHHFDSKNVDLTDLLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQ
ESSQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPI
VTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITG
TTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMND
PVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQ
LVFNFYAFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKE
TESDQDDEAEKADRRQSFASLALRKRYSYLTEPGMIERSAGATRSLPTTYSYKPFFSTRP
YQSWTTAPNTVPGPAKSGFTSLSSSSSNTPSASPLKSIWSVSTPSPIKSTLGASTTSSVK
SISDVASPIRSFRTISSPIKTVVSQSPYNLQVSSGSLGRPPAVTEASPLKGLASNSTFSS
RTSPVTTGGSLLERSSITMTPPASPKSNLNMYSSSLPFKSIITSATPLISSPLKSVVSPA
KSAVDVISSTKVTMASTLSSPLKQMPGHAEVALVNGSISPLKYPSSSTLINGCKATTTLQ
DKISTATNSVSSVVSAAADTVDKAFATTTAMPFSPLRSYVPAATPSAFPSLRTPPTSALY
TSLGSSISATTSSVTSSIITVPVYSVVNVLPEPALKKLPDSNSLTKSAAALLSPMKALTT
ETRPQPHFSRTSSPVKSSLFLAPSALKLSTPSSLSSSQEILKDVAEMKEDLMRMTAILQT
DVPEDKPFQPELAKEGRMEDEEPFKIVEKVKEDLVKVSEILKKDVCVENKGPPKSPTSDA
GHSPEEDWTEFSAEELREARQAAASHAPSLPERVHVKAKAASDKDYNLTKVIDYLTNDIG
SSSSLTNLKYKFEDAKKDGEERQKRILKPAMALQEHKLKMPPASVRPSTSEKELCKMADS
FFGTDTILESPDDFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHEVPIPPV
ITETRTEVVHVIRSYEPSPAGDTPQAQPEEPVSPKPPPTFMELEPKPTMSSIKEKMKAFQ
MQANGGTCDGEDHSRALSKGMRVKEETHITTTTRTVYRSPPGSEGTSERIEETMSVHDIM
KAFQSGRDPSKELAGLFEHKSAAVAPDTPKTAAEASAQHTEKDTQMKPKLERIIEVHIEK
GNQAEPTEVIIRETKKHPDKEMYVFQKDLSRGDINLKDFLPEKHDAFPCSEEQGQQEEEE
LTAEESLPSYLESSRVNTPVSQEEDSRPSSAQLISDDSYKTLKLLSQHSIEYHDDELSEL
RGESYRFAEKMLLSEKLDVSHSDSEELVTDHTGPPSSELQGSDKRAREKVAPAPKKEILS
KIYKDVSENGVGKLSKDEHFEKVTVLHYAGDVGSPKHAMWMHFSEDRLDRGREKLIYEDR
VDRTVKEAEEKLTEVSQFFRDKTEKLNDELQSPEKKPHPRNGKEYASQSSTCGSPEKALL
KELLVSNEEWVRTRQQGPDAPGLPKVEEERPRRSSSPEKRAPLAPHAEDGQATENAQRSQ
GLPSQAPDGPQAGFQLKQSKLSSIRLKFEQGAHPKSRDVSEEDRRSDGQSRIPVKKIQES
KLPVYQVFAREKQQKGLDLAEEPRAVQNDLLVLKAQDEHGQSNKIVVNDSGSDEVKQPRT
DQSKQGVPDHFSEQQATTNLACPGTSDLAPAKGPWDKKVFRTWESSGPSNNKSQKEKLSH
VLVHDVRENHVGHPQSPSSDPENEFMPVTEREHKVLTNGSLSEIKEMTVKSPSKKILYRE
YVVKDGDHAGGSPLQPSRKTESPTVSHIPVRVAEDRSAPAPSIPRGLCEPATFPKPELSQ
KVAQSSLSKETVETKHLNSIQDAKVTYSEISKVSKQSYVGLCPPLDETETSPTKSPDSLE
FSPGKESPSSDVFDHSPMDGLEKLAPLAQTEGGKEIKTLPVYVSFVQVGKQYEREIQQGS
VKKIVSQECKTVQETRGTFYTTRQPKQPPSPQGSPEDDTLEQVSFLDSSGKSPLTPETPS
SEEVSYEFTSKTPDSLIAYIPGKPSPIPEVSEESEEEEQARSTSLKQQTVEETSITPEMP
SDASRDSSLRPKTNRVAYIEFPPPPPLEADQPEPQKAPYLPEKEVDMIEVSLQDEHDKYQ
LAEPVIRVQPPSPVPPGADVSDSSDDESVYHPVPVKKYTFKLKEVDDEQKEMTKTKASAE
KVPAQKELESNGSGKDNEVGLTLDSPQNETAQNGNNDQSITECSIATTAEFSHDTDATEI
DSLDGYDLQDEDDGLIESDSKLPGQTVELKKDVWNMEGILKPADRSFSQSKLEVIEEEEG
KVGPEDDKPSSRSSSAEKTSDKTEQKSGTQFFTLEGRHPDRSVFPDTYFSYKVDEEFATP
FKTVATKGLDFDPWSNNRGDEEVFDSKSREDDTKPFGLAVEDRSPATTPDTTPARTPTDE
STPTSEPNPFPFHEGKMFEMTRSGAIDMSKRDFVEERLQFFQIGEHPSEGKSGDQGEGDE
SMVTATAQPQSGDTTVETTVERNAEAPPVEPPPSSPTSAECQEGPARSSSPERAAAASST
SKTDPKLRTPIKMGISASTMTMKKEGSGEATDKIDAVVTSGQGLEHEAVSVISNAVNSQM
GTRPQEKHDFQKDNFNNNNNLDSCTIQTDHTMSNVVLREQPTRSCTTEKGNLLKGSAGKK
TGVQQGHCVKDKQKVLGEQQRIKESVGIRQKSKLPKATSPKDNLPPNHIPRIKASKTKQV
SQSEKARTIPPSSCIGGKSRIPIKNTHRDNTVSVRKACATQKQGRPERDKAKQVPSKLPV
KVRSTCVTTTSTSTTTSTTTTSTSTIKVRKNQLKEVCKHSIEYFKGISGETLKLVDRLSE
EDKKMQSELSDEEESTSRNTSSLSETSRGGQPSVPTKSTRDKKTEAAPLKSKSAKAGSER
RSSRRTGPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSF
MLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENSAFHD
SVDGWQNETSSGNLESPAQARRITGGLLYRLDDSPDQCRDSITSYLKGESGQFEANGSHA
EVTPEAKRKAYLPESQNDIGKQNAKEILKPKIHGAARVEEPASPLTAYQKSLEETSKLGI
EEPKPCVPVTMKKMNRTCPAPGKPRLNLQEEEGSSGPEQKQGEAYVKEEIRHVEKKSY
Download sequence
Identical sequences ENSOPRP00000013592 ENSOPRP00000013592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]