SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014234 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014234
Domain Number 1 Region: 325-445
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 4.56e-32
Family Vertebrate phospholipase A2 0.00041
Further Details:      
 
Domain Number 2 Region: 83-121
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.000000617
Family Vertebrate phospholipase A2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014234   Gene: ENSOPRG00000015575   Transcript: ENSOPRT00000015583
Sequence length 495
Comment pep:novel genescaffold:pika:GeneScaffold_2028:145859:174654:-1 gene:ENSOPRG00000015575 transcript:ENSOPRT00000015583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCSLSPAMILLLLLGVLLVPSTEGHALDTPHLPRELPPGLSKNINITFFNGVFKNVEGVA
EIFDCLGSHFTWLQAVFTNFPALLQFMNGMKCVAGLCPREFEDYGCACRFEMEGLPMDEP
DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXSAEIFATVKNIALSSAGARSVGLVMSSVESSP
EETTGKACDRLTFLHLGSGHNTLVMPQLGEMLFCLTSRCPEEFESYGCYCGQAGRGEPRD
ALDRCCLSHHCCLEQMRRLGCLPERLSQSAVMCVDHIPKCAGHSLCQKLLCACDQVAAEC
MASASFNQSLKSTDRQECQGMQVSCDSMQGGPAASPLGSSSEENSEEYIPQEGPRRARRF
LRKSLGPLVTPLLES
Download sequence
Identical sequences ENSOPRP00000014234 ENSOPRP00000014234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]