SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015833 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015833
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 2.35e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015833   Gene: ENSOPRG00000017346   Transcript: ENSOPRT00000017346
Sequence length 69
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3293:44984:51539:-1 gene:ENSOPRG00000017346 transcript:ENSOPRT00000017346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQDLSEKELLKMEVEQLRKEVLNPRAPISKTGKEIKDYVEAQAGNDPLLKGVPEDRNPF
KEKGSCRIS
Download sequence
Identical sequences ENSOPRP00000015833 ENSOPRP00000015833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]