SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CC1G_00836T0 from Coprinopsis cinerea okayama7 130 v3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CC1G_00836T0
Domain Number 1 Region: 62-111
Classification Level Classification E-value
Superfamily DOPA-like 0.00000000981
Family DOPA dioxygenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CC1G_00836T0
Sequence length 113
Comment | CC1G_00836 | Coprinopsis cinerea okayama7#130 hypothetical protein (114 aa)
Sequence
MASSHLSSAVTSFNMSQPQWKSPLEGYENLPPLPDTINPDGKSLYNPPTDKLSDAYANFQ
KPIDSSNNGFDFHIYYRTEDEAETKFARELHERIRREFPEIRIYKFWDRAVVF
Download sequence
Identical sequences A8N8W1
XP_001831289.2.59657 CC1G_00836T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]