SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CC1G_07247T0 from Coprinopsis cinerea okayama7 130 v3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CC1G_07247T0
Domain Number - Region: 116-179
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0034
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CC1G_07247T0
Sequence length 233
Comment | CC1G_07247 | Coprinopsis cinerea okayama7#130 hypothetical protein (234 aa)
Sequence
MAKWDGGYEEGRARVFTAVNSACHDRDRFEDWFFDNIGGPCNHEECIKFPGGCMLTAEGL
GCAPCIKKGRPCPWKDAYIITVILGELEVPYGKAFQFFTKLLKDPIFRDILRGEYSRNPD
PSGVLNPVQIQGRLHEVELELKEAREEIERRDAKLKRLIEDLKETKERLADCKRELSIYT
QRQVELAPAGSNNPAAERSSRPFYIGSKRSLAAYRQSGCREERTLNQTRNQIR
Download sequence
Identical sequences A8PD31
XP_001840517.1.59657 CC1G_07247T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]