SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g15280.1|13108.m09254|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g15280.1|13108.m09254|protein
Domain Number 1 Region: 36-203,266-285
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 5.36e-96
Family Cytochrome f, large domain 0.0000000154
Further Details:      
 
Domain Number 2 Region: 203-265
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 6.28e-20
Family Cytochrome f, small domain 0.0000657
Further Details:      
 
Domain Number 3 Region: 282-320
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00000000000000144
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g15280.1|13108.m09254|protein
Sequence length 320
Comment apocytochrome f precursor, putative
Sequence
MENRNTFSWVKEQMTRSISVSIMIYVITRTSISNAYPIFAQQGYENPREATGRIVCANCH
LANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQVLANGKKGGLNVGVVLILPEGFELAP
PDRISPELKEKIGNLSFQSYRPNKKNILVIGPVPGKKYSEIVFPILSPDPAMKKDVHFLK
YPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGVVRKILRKEKGGYEISIVDASDGRQVID
LIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFFASVILAQ
VFLVLKKKQFEKVQLYEMNF
Download sequence
Identical sequences Q6Z501
39947.LOC_Os08g15280.1 LOC_Os08g15280.1|PACid:21891095 LOC_Os08g15280.1|13108.m09254|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]