SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os09g01680.3|13109.m07550|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os09g01680.3|13109.m07550|protein
Domain Number 1 Region: 31-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.83e-30
Family RecA protein-like (ATPase-domain) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os09g01680.3|13109.m07550|protein
Sequence length 256
Comment DNA repair protein RAD51 homolog 4, putative, expressed
Sequence
MLSGWNGLAQGCDGEQALPPHGPSRVLLSSIVDALLGGGLRQGQLTEITGQSSSGKTQVC
LCSASHVAARQLGVVMYLDTSNSFSPSRIARIVDGFPISLVREPKNVRLERVMSSIICKS
VFDIFDLFEVLHQLELSLKSKVNNGGNKICLLIIDSISSILAPINGGKYPRGRSMMISVA
MILKKLAYEHNLSVLVTNHMVAGNGAPKPALGESWKTVPHVRLVISRERGSKICAATVLK
HTLLASGRVMKFAVPS
Download sequence
Identical sequences A0A075DNI1
XP_015612423.1.37577 LOC_Os09g01680.3|PACid:21927069 LOC_Os09g01680.3|13109.m07550|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]