SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os09g08880.1|13109.m00753|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os09g08880.1|13109.m00753|protein
Domain Number 1 Region: 2-140
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.29e-43
Family RecA protein-like (ATPase-domain) 0.000000445
Further Details:      
 
Domain Number 2 Region: 142-270
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 3.66e-41
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os09g08880.1|13109.m00753|protein
Sequence length 284
Comment ATP synthase like protein, putative
Sequence
MADSPATLQYLAPYTALAEYFMYRHTLIIYDDLSKQAQAYRQMSLLLRRPPGCEAYPGDV
FYLHSRLLERAAKFNSLLGEESMTALPIVETQSGDVSAYIPTNVISITDGQIFLSADLFN
AGIRPAINVGISVSRVGSAAQIKAMKQVAGKSKLELAQFAELQAFAQFASALDKTSQNQL
ARGRRLRELLKQSQSNPLPVEEQIATIYTGTRGYLDSLEIGQVKKCLDELRKHLKDTKPQ
FQEILSSSKTFTEEAEILLKEAIQEQLERFSLQEQTTILHVYSC
Download sequence
Identical sequences LOC_Os09g08880.1|13109.m00753|protein 39947.LOC_Os09g08880.1 LOC_Os09g08880.1|PACid:21927781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]