SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os11g13900.1|13111.m01420|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os11g13900.1|13111.m01420|protein
Domain Number 1 Region: 154-228
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000139
Family B3 DNA binding domain 0.016
Further Details:      
 
Domain Number 2 Region: 2-51
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000471
Family B3 DNA binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os11g13900.1|13111.m01420|protein
Sequence length 232
Comment hypothetical protein
Sequence
MTVELEKIAGSFFISKGWKTFVHRTGLLSGQYIRFQVLTPSKINVLLFDKKKDSKLPMIP
SSKKQIKTAPKRSTGITINDMPTSKHASMLISHTSNKETSSDSRTESMTDIPSSSDNSGE
TTRSFDDLCFCARNTAVTPDIKNYISIIGQFLQRSSKFYIVTMNNTFMKQDRLVEAAGSD
SVTMLLHKSSDDRCNLKRGWATFAATNAIHLHSVCIFHFYKPPNVKITIDVL
Download sequence
Identical sequences Q53N90
LOC_Os11g13900.1|13111.m01420|protein LOC_Os11g13900.1|PACid:21947938 39947.LOC_Os11g13900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]