SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g72020.2|13101.m07847|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g72020.2|13101.m07847|protein
Domain Number 1 Region: 279-384
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.24e-19
Family Ankyrin repeat 0.00097
Further Details:      
 
Domain Number 2 Region: 9-53,95-128,186-211
Classification Level Classification E-value
Superfamily POZ domain 2.04e-17
Family BTB/POZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g72020.2|13101.m07847|protein
Sequence length 505
Comment BTBA3 - Bric-a-Brac,Tramtrack, Broad Complex BTB domain with Ankyrin repeat region, expressed
Sequence
MEETLKSLSMDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGAAADQA
AAPPGALLLDHLSPRSPSGGASASSPRGAGGSAAAAAAATPGAVIPVSSVSYEVFLLLLQ
FLYSGQVSLVPQKGEPRPGCGERGCWHTHCAAAVDLALDTLAAARSFGVEELALLTQQLA
GMVEKASIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIDELR
LKSMSRRSPFLSHHHHHPHAAAAGIEASSAAELDDHHKIRRMRRALDSSDVELVKLMVMG
EGLNLDDALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVAV
LLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLAHIEPNKLRLCLELVQSAAMVM
SREDAQTAAVNAAPIYGESPGGGGGGGVYNASGTSSSMVNLSLDNRMVYLNLGMDAQFGK
MNDGGDGDDGGSRGPSSLFSPHGFP
Download sequence
Identical sequences LOC_Os01g72020.2|13101.m07847|protein LOC_Os01g72020.2|PACid:21907075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]