SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g18450.1|13102.m02069|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g18450.1|13102.m02069|protein
Domain Number 1 Region: 74-275
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.06e-53
Family G proteins 0.0002
Further Details:      
 
Domain Number 2 Region: 223-370
Classification Level Classification E-value
Superfamily Translation proteins 3.12e-28
Family Elongation factors 0.0072
Further Details:      
 
Domain Number 3 Region: 470-585
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.31e-28
Family EF-G/eEF-2 domains III and V 0.0059
Further Details:      
 
Domain Number 4 Region: 375-459
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000000000299
Family EF-G/eEF-2 domains III and V 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g18450.1|13102.m02069|protein
Sequence length 669
Comment GTP-binding protein typA/bipA, putative, expressed
Sequence
MQMQAATTTTAARRLAPKPQPQANRCRPSSVSVVAAGRSRRRSARSSLRASASLDQEVKE
RASPAAGKSGQATRRDVRNIAIVAHVDHGKTTLVDSMLRQAKVFRDNQVVQERIMDSNDL
ERERGITILSKNTSITYKGTKINIIDTPGHSDFGGEVERVLNMVEGVLLVVDSVEGPMPQ
TRFVLKKALEFGHAVVVVVNKIDRPTARPEFVVNSTFELFIELNATDEQCDFQTVYASGI
KGKAGLSPENLGDDLGPLFEAILRCIPEPRIEKDGALQLLVSNTEYDEHKGRIAIGRLHA
GELQRGMEVKVCTPDDACRISKISELFVYQNFSRVPVDNVSAGDICAVCGINDIMIGETI
ADKVSGTPLPTIKIEEPTVRMSFSINTSPFVGKEGKYVTSRNLRDRLYRELERNLAMKVE
DGETADTFLVSGRGTLHLTILIENMRREGFEFMIGPPKVINKTVDGKLQEPYEIAAVEVP
EEYMGSVVELLGKRRGQMVDMQPSGPEGTTLLKYKIPTRGLIGLRNAVLTASRGTAILNT
IFDSYGPWAGDLSSRDQGSLVAFEDGSTTSYALLNAQERGILFVSPGQDVYKGQIVGIHQ
RPGDLAINVCKKKAATNVRSNKETTVVLDEALSYSLDDCIEFIQEDELVEVTPASIRMCK
NPKVSKKNR
Download sequence
Identical sequences I1NZG9 Q6KA61
LOC_Os02g18450.1|PACid:21918725 XP_015627401.1.37577 LOC_Os02g18450.1|13102.m02069|protein 39947.LOC_Os02g18450.1 ORGLA02G0112500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]