SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g22280.1|13102.m02501|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g22280.1|13102.m02501|protein
Domain Number 1 Region: 862-940,993-1025,1059-1187
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.5e-37
Family Tandem AAA-ATPase domain 0.01
Further Details:      
 
Domain Number 2 Region: 719-936
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.79e-17
Family Nitrogenase iron protein-like 0.072
Further Details:      
 
Domain Number 3 Region: 1384-1480
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000051
Family B3 DNA binding domain 0.013
Further Details:      
 
Domain Number 4 Region: 1274-1349
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000011
Family B3 DNA binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g22280.1|13102.m02501|protein
Sequence length 1486
Comment retrotransposon protein, putative, unclassified, expressed
Sequence
MGPKKCALQKEGSNSGKGAATSNDLEREGRRTLDPKTLRRLAQNREAPRKSSLSKKAYIQ
QLKSSRIRLSQLAQQVHVARVQRALLFRLVVNMPGKQLLRSVKVKGFLVYRPCLPIETSK
DITQCRMCGAQFWYQERCKRDSAITQRRMSYSLCCKGGKIFVPPFAQPPEPLNSLLKFDG
DARSRHCLQHIRQYNSLFAFTSMGANIDDSLNRGGGPYVFKINGQVHHRIGSLLPSEETP
LKFAQLYIYYDTQNEIENRMRALLNEEVEDCDLDPQIAAELLDMLDNCNPLVKQFRIARD
RLADNGDEQFAIRIVGSDENGPVQYELPTADELAGLIVGDFSLENAKRDIIVQSIPGPLH
VSSLHPAYMALQYPLLFPYGQVDGYACVEEGRLTFIADQQRELRCEHMQGITDAVAKGSL
DGASVVLYSVEFQKRGLPHVHILVWRDAPSTDATPSIVDTYISAELPDPNENELDYLLVK
EFMMHGPCGDSNRKCPCMRNGSCSKKYPKDFNSETTVDDKGFVVYRRRDNGSHVLKNGIK
LDNRSVVPYNVSLLRKFEAHINVEWCNKSKMIKYLFKKKMRGSDFTVPAPIDEIADFIEC
RYLCANQCEGYFMRMLLMYVRGARSYADIRTYNDVVYDTFKEACAARGLLGDDREWSFAF
DEAVSWGTGPQLRSLFVLMVVHCGIADGAAFFNKHWHAMSDDILFDLQQSLNNAAYSVPD
NELRNMVLQELHMLFFAMSVMTKSPAFYFVSGFGGTGKTFLWNCIVTYLRSEKKLVLAVA
SSGVASLLLPGGRTAHSRFKIPIEIDETTICHIKRGTMLADLIKSTSLIIWDEALMTHRR
CFEALDRTLRDILSEDDHSAASIPFGGMVVVLGGDFRQILPVVEGGVRSKTIDATISKSP
LWSYVCVLELSINMRLRCSSLDSDMQREVAEFSDWILSIGDGTAAACSYGSDVEPTWIEI
PHDLLVMNNDEKIGAIVAAVYTNFAEQYNDPVYLQDRAIVSPTNDVCAAINSWVLQLFPG
EAREYLSFDRLAKTNEKSDDLDVLYPIEFLNSIKVNNYPEHQLCLKIGVPIMLLRNLDQT
AGLCNGTRMIVTNLGDRVIEARIITGSNAGETVYIPRITLSATSKKWPFTLERRQFPVRV
CYAMTINKSQGQRLRSVGIYLKNPVFCHGQLYVALSRVTSRAGLKMPFDLFCDISPTSKN
WKICATIARNESCQPLGASKKLTFEVGASEGKDIDTAVVSERQWTRLNQVLSYVLCSCSV
ILVHAKGDTAMNPPRFFTVRLTTANQRYVRRPAAIAQGYQLEDGQRLKLVTTHNLMVYIE
LKRASGKIYITTGWPQFIEATGLQLKEYVATPNALSMKCASAPGRDINLSTELKDYFKDI
AQFLHPSNEFYVTTINPTFMKQDKHFSKQFSMTYIALIVRKKTSQIEVRIPGHSSTTMVL
HHSTEKRFNLKSGWTHFPTSNGIQVGTICIFHFHQTNQLQATIDVL
Download sequence
Identical sequences 39947.LOC_Os02g22280.1 LOC_Os02g22280.1|13102.m02501|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]