SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g24750.1|13102.m02681|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g24750.1|13102.m02681|protein
Domain Number 1 Region: 436-532
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000353
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g24750.1|13102.m02681|protein
Sequence length 539
Comment expressed protein
Sequence
MVAARRRRRPRRRVRPPPVATPSSDPRLAAAGTGASTPPPPLPRRRMWSGWRWGRRRGRG
ACSPVDPAVLEAGLVWRLLAAAGQLTRGGAVAVAVDALLFEHLWWLQHTPTSSLPSPSWV
INSPSSRPLAPPDSVDVIPPLAIVGRRAATPPPLPSHAAGPCRKTSTGHNHRCPLLQQIH
ATGRRPQSQCDLEVEKLGVGWVGLYEGFEGVCIADHGCGCVVLPSWDAGSDRCSGRGDDC
FFLGWEPPFANLAAADARISFPVCVPEDLWDASNSSNSDRARLIPAMFSIMYGKVGISAD
TPSSTSDSFFSDSLNSSCGQSLIGMVLVTTFCYLKSVVQVPLAFIVAPDIFRINRDILSF
VSCIVSNQIKQTCASIIQDTSDTSSNTKTDLSSDTPSNTTMTGSTKRAFNELCFCAKNVD
PTADLKKYIEDLECLDRSSKFYAVAVNNTFMKQDRVYCTKEFSQDYLKPLMEGKETISIG
VQIAGGVSKNMILHMSTDGRCNLKKGWAKFATHNHIYLQSLCTFHFYKTTRLEATFDVL
Download sequence
Identical sequences 39947.LOC_Os02g24750.1 LOC_Os02g24750.1|13102.m02681|protein LOC_Os02g24750.1|PACid:21923159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]