SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g54590.1|13102.m06252|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g54590.1|13102.m06252|protein
Domain Number 1 Region: 420-695
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-69
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 16-129
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000000385
Family Universal stress protein-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g54590.1|13102.m06252|protein
Sequence length 772
Comment serine threonine kinase, putative, expressed
Sequence
MGKDGGDPGGGGYPLVAVCIDKDKNSQNALKYATESLAHKGQTIVLVHVHTKGSSGGVED
AAGYKQPSDPQMKDLFLPFRCFCTRKDIHCKDVVLDDHDVSKAIVEFAAHAAIEKLVVGA
TARGGFVRFKAEISSSISKTAPDFSTVYVVSKGGKVTSVRQAVRQAPAVSPLRTMIQGPK
PDNVSTQKWTPPPPPSTTRPDIAGTPKIQDNFIMSPFARGANTSVRKAFPDYSMPESSDI
SFISSGPRRSLDLYPPRLSSGSDAHDHHSFEATRPPSMWGGDSFGSDSQSSNSSFASSLP
MEDMEAEMKRLRLELKQTMDMYSTACKEALTAKQKAMELQRWKTDEEQRSHETRLTEESA
MALIEQEKAKARAAIEAAEASQRLAEMEAQKRISAEMKALKETEERLKSMGGGGSRGAVR
YRKYTIEEIELATEHFADGRKIGEGGYGPVYKGHLDHTPVAIKVLRPDAAQGRSQFNQEV
EVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDCLFRRGGGPVIPWQHRFRIAAEIA
TGLLFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLARLVPPSVADSVTQCHMTSAA
GTFCYIDPEYQQTGMLGVKSDVYSLGVMLLQIVTAKPPMGLTHHVARALDHGTIVDMLDP
AVHDWPVDEARCFAEISIRCCELRRKDRPDLATVVLPELNRLRALGEDNMQLCNTMSGGG
RSSMHSSPYNSNSSMHQPHRQTDMAIEHSVGRSSYDADTSQQAMQGRRLNYN
Download sequence
Identical sequences Q6K4Q1
39947.LOC_Os02g54590.1 LOC_Os02g54590.1|13102.m06252|protein LOC_Os02g54590.1|PACid:21922524 XP_015627356.1.37577 XP_015627357.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]