SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g20949.2|13103.m02511|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g20949.2|13103.m02511|protein
Domain Number 1 Region: 38-130,277-325,353-413
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 6.28e-28
Family Calcium ATPase, transmembrane domain M 0.038
Further Details:      
 
Domain Number 2 Region: 141-201,235-272
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00000000000000772
Family Calcium ATPase, transduction domain A 0.0089
Further Details:      
 
Domain Number 3 Region: 406-443
Classification Level Classification E-value
Superfamily HAD-like 0.0000133
Family Meta-cation ATPase, catalytic domain P 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g20949.2|13103.m02511|protein
Sequence length 480
Comment phospholipid-transporting ATPase, putative, expressed
Sequence
MAEEHDHHGSSRHMSASQKELGDEDARVVRVGDAERTNEQLEFAGNAVRTAKYSPLTFLP
RNLFEQFHRLAYVYFLVIAVLNQLPQLAVFGRGASVMPLAFVLTVTAVKDAYEDWRRHRS
DRAENGRLAAVLLSPGAGTHFAPTKWKHVRVGDVVRVYSDESLPADMVLLATSDPTGVAY
VQTLNLDGESNLKTRYAKQETLTTPPEQLTGAVIRCERPNRNIYGFQANLELEGESRRIP
LGPSNIVLRGCELKNTTWAIGVVVYAGRETKAMLNNAGAPTKRSRLETQMNRETLFLSAI
LVVLCSLVAALSGVWLRTHKADLELAQFFHKKNYVSDDKNANYNYYGIAAQIVFVFLMAV
IVFQIMIPISLYISMELVRLGQAYFMIRDTTLYDASSNSRFQCRALNINEDLGQVKCVFS
DKTGTLTQNKMEFRCASVGGVDYSDIARQQPVGRRTSSLLSYPEFFPFGAGSHGWGADGF
Download sequence
Identical sequences Q10M23
LOC_Os03g20949.2|PACid:21914550 LOC_Os03g20949.2|13103.m02511|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]