SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g44780.1|13104.m04478|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os04g44780.1|13104.m04478|protein
Domain Number 1 Region: 39-170
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.12e-34
Family Pollen allergen PHL P 1 N-terminal domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g44780.1|13104.m04478|protein
Sequence length 343
Comment beta-expansin precursor, putative, expressed
Sequence
MAAASSRSFSLCVLLLLLLLAPPISASFLFDGGKSKSAAAAAAVDMEWRPATATWYGDAE
GDGSTGGACGYGSLVDVVPMKARVGSVSPVLFKDGEGCGACYKVKCLDHGICSRRAVTVI
VTDECPGGLCAFGRTHFDLSGAAFSRMAVAGAGGHLRDRGQLSVVYRSVQIYQDCVQVRR
EEHSLPCKRGLDELLAVTAGRVRGRPGRHWIHADKAGELSGVAGHEACVGGHVVPRAGPA
CRALLGEVDDAVGPEGAHGPGRHPQELEAHGHLHLAPQLRGRPLIGWGSAGPGPTFYRPG
KLPGGPAKAGPTWQSVRQESQASSIVMQLIILVGLIIHDSIHG
Download sequence
Identical sequences LOC_Os04g44780.1|PACid:21894658 LOC_Os04g44780.1|13104.m04478|protein 39947.LOC_Os04g44780.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]