SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g46690.1|13104.m04705|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os04g46690.1|13104.m04705|protein
Domain Number 1 Region: 253-514,559-764
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.82e-81
Family Hermes transposase-like 0.0019
Further Details:      
 
Domain Number 2 Region: 796-885
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000334
Family B3 DNA binding domain 0.0063
Further Details:      
 
Weak hits

Sequence:  LOC_Os04g46690.1|13104.m04705|protein
Domain Number - Region: 105-163
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000464
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number - Region: 197-255
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 0.0144
Family Hermes dimerisation domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g46690.1|13104.m04705|protein
Sequence length 899
Comment transposon protein, putative, unclassified
Sequence
MAARSGMGGGCSSAPLTTAVDLAKHRPSFASPVQEEPHGGQQQPTASAMSVNLQRQLSIE
IESPSNRDGIAATEAQPNQQLVPGEVRGEEGQEGNPTKATRKKKSPLWDFFEECTVPSKK
KKGEMENKVKCKACETLLTKNSSGTTTHWRRHLEQCDYHKLQQKSIKQQNINFPSLDEGD
VDLDAPCVSVPGYYDPTKIRELICKMIIVHELPFYLVEYTWFNVLLKRLNPSYKKVSRNT
IRSDCMRLYESEKEKLKRTFKDVRKISLTCDLWTSNQTICYMSLVAHYIDADWSMHCRVI
NFLELEPPHTGVVIANAISDCLASWRIEDKIASITFDNASSNDSAANLLLAKFTKRGSLW
FYGKFLHIRCCAHILNLIVQDGLAVIKHIIDKVRDTIKYIKKSNNRAYKFSADIDSLNLK
SDMGLAIDSCTRWGSTFKMLQSAFFYRSALDVYAAGDANYRWLPTPEEWNLYCEVNDALS
VIHAATEEFSGSTYPTSNLFYSHIVDIKRVLDFKFEGDRRYSHRVHEYRGATGWLQGDMV
NLERHGLIPVGTSSGRDMKSKDPILKEMANAMLEKFEKYWGPECNTLFAVALVLDPRFKM
GMINYTFPALYEETVLPKKLANVESTLKSLHASYESELQSTSKENDATTQSTSTSLGTTS
SHFFAASQFHEYMKSKNAASLPKSDLKRYLDDPVEDIPAKSFNLLQWWRMNELKYPIVAK
LAKDILTIPITSVSSESAFSTGGQVISDYHSSLLPSTAQALVNMDLAPSLDLIGSTGMGL
NMQYKIAHIAVSNLPTIPLYVYEIQMTNLTKGKMAFSLPFSKQYINNHLSTPIDDLLVTL
VGSAESFEMRLKKSKDKRATFTTRWNKLVQANLFELGDVCVFLFTEVDDDLCITLEVLN
Download sequence
Identical sequences Q7XUL5
39947.LOC_Os04g46690.1 LOC_Os04g46690.1|PACid:21895518 LOC_Os04g46690.1|13104.m04705|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]