SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g52460.1|13104.m05379|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os04g52460.1|13104.m05379|protein
Domain Number 1 Region: 553-770
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000192
Family Tropomyosin 0.00079
Further Details:      
 
Domain Number 2 Region: 265-474
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000159
Family Tropomyosin 0.0025
Further Details:      
 
Domain Number 3 Region: 1207-1432
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000327
Family Tropomyosin 0.0032
Further Details:      
 
Weak hits

Sequence:  LOC_Os04g52460.1|13104.m05379|protein
Domain Number - Region: 956-1239
Classification Level Classification E-value
Superfamily Tropomyosin 0.000305
Family Tropomyosin 0.002
Further Details:      
 
Domain Number - Region: 483-587
Classification Level Classification E-value
Superfamily Tropomyosin 0.00294
Family Tropomyosin 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g52460.1|13104.m05379|protein
Sequence length 1809
Comment retrotransposon protein, putative, unclassified, expressed
Sequence
MEVEQAAEVGEVTAPKLPDKAVDKAQVHDDDKENLVNGNSNLQVKEAHNDEDDGTGSDGF
ELIDVKENFDSAKVVEEEKASPIEQGKTAALEEQALTRESAMLNQEAKQLEELTRRIEEL
ELEKEKLVKGVTEAENKQNLHYTSLQEAQRSLADKDKELADATQSLKELGSELESSKERI
QEIEAELAASADKLHKLEELKDERSLHAAQEAKRASELDKTLETAQLNMKEMEAQISSLQ
EEIKGHQDKAIDHQQVEESLRSTLSELKMNRLKEKTLKLENELSSAHEELQAKILNLQEM
EIKLEEQAKEKQTWEATLEKQQEQILNLQTELDESKGGNETLRGTIADLNSKLAERDSLL
RQAEDEHAKAQLLLSEALSHKDELEVNLKSINEQHGESRAAAENASQKILELEALLQTLH
ATEEALKLQLEEAEARVEVAEKKGSDLEQLLGESENKLVASSGELKLLEERVQQEAASSA
EKEKLLEEATNSVEAYKEKINELQASLDSTTSKNQLLEQEVKDLSDKFTEHQEQAHSVHE
RSLELESLLHTSKSDAEVAHTRTQDLENELNTANEKFKEVEADLEQYRSKVSQLSDELEA
YQTKAASLEAVMESASEKEKELVESLGQITEEKKKLELLVLEYEEKTEEYLKEKQSLEER
LQSQESKVLALEESLVKMGEEKESHEGTIADLNLQLSNKNDMYMQLESQLSQAGDDHSKT
RSLLSEAQLHKEELELNLKSLNDLHVESKTAAESALQRIAELETQVQELSAAEQSLKSHL
TEFESKLASAEKKSMDLEQELKDATEECNSSRLRVDELSGELEEYKEKRTSLEASLLEAK
QKEAELSEKLDQVNEEKEKFEELSKKATIKHLEAENQVQALQGELESARHKLEEVESDLE
ALGIRETSVLDKLKSAEEQLEHKGKALEHATSKKIDLEALYQSLLEDTEMKLQQAGENLT
QKETECQELSEKLKAAEEQAASYQAKATAAAEEVESVKVELEAFETEISTLETTIEELKT
KASNAESRAEQALVESAMMSETNQALKEDLDAKLAMLRELQEQFDSTHAEKEEVFTKLSA
HEKTIEHLTEVHSRGLELHATAESKNAELEAQMHEALETIGKKDSEVKDLNERLAALESE
IESLTHVNEAMKQEINAKLVKVDELQEKLSSISSEKEEVAEKVVVHEKTIEHLREEHSRG
LELQSAAESRSAEIENELREVLETVAQKEAEVTDLKEKLVSLETENEKLVGINEALKGEL
DTKVAMFDELQEQFSSTHAEKEEAAEKLAVHERTISHLTEVHTRSLELHSAAESKNEEIE
SKLHEALEMAAQKEAEVKDLSKKLDALEIELGYYEEQATEAAAAEETHKIKFDEAVHKIK
SLEEQLAVTENKVELFHTEKENLVIANSKLNEELELHQNKLNELQVALAAAVAEKEGSSE
EIHSLRKTLDGMIQRKEELESQVSSTVEEHEELKSKYNITLEEKQLLNEKYESAKKELGE
AIAKLEEQMNVDKSEKELHISKLERQITLSELKYMEEIQTMQVETTEKDEALTTKMQEHA
NLVHEKDALEQQLLEVRKELNDAYHTIANQEEQVSVREIKWDAYKKFSEDQLEAEQQHVA
ELEVQVSSLKQQLQETEIHYKHKEEQVSLREVQWEADQEHSVSELKAQRQYAAELEKQIG
ALTQQLQLVEKQYEQKVTEEREKLALVNTEVSKLTQKLSKSAEMEKKIEHLEQKLQAKDS
VESTSRDFSLDSSTLPSKQRDRSLAPETTPPNPTQQQELREPSGIMAFKFILGVALLSVL
IGVFLGKRY
Download sequence
Identical sequences 39947.LOC_Os04g52460.1 LOC_Os04g52460.1|13104.m05379|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]