SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g40280.1|13105.m04259|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g40280.1|13105.m04259|protein
Domain Number 1 Region: 132-228
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.37e-24
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g40280.1|13105.m04259|protein
Sequence length 279
Comment B3 DNA binding domain containing protein, expressed
Sequence
MAAEAGSAAAGAAYEEERRKRVLENLKHLEDLGIKKMSKSLLEAARLQKSTRASPKPRKK
FEVGATEVRRSSRARNSVSYKENFDELNSFLCRRRGSRIRSTEQGRDYTGRVASYEQQQR
AFKKAERLQNSLDPENPSFVKTMVRSHVSSCFWLGLPTRFCKLHLPPKEYKMVLEDEEGG
EFDSVYIGNRTGLSGGWRGFAMHHNLEDGDSLVFELAEPDRFKIYIIKAVDEDANESEPA
DEEAIGDKDTSTEDAAEQDDSPNAEPLKGTKRRKLRGRR
Download sequence
Identical sequences Q5KQI4
LOC_Os05g40280.1|PACid:21940798 LOC_Os05g40280.1|13105.m04259|protein 39947.LOC_Os05g40280.1 XP_015639491.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]