SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os06g02160.4|13106.m00134|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os06g02160.4|13106.m00134|protein
Domain Number 1 Region: 12-566
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.49e-98
Family Acetyl-CoA synthetase-like 0.0000159
Further Details:      
 
Domain Number 2 Region: 791-1096
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.14e-38
Family Quinoprotein alcohol dehydrogenase-like 0.0064
Further Details:      
 
Domain Number 3 Region: 582-645
Classification Level Classification E-value
Superfamily ACP-like 0.00000846
Family Peptidyl carrier domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os06g02160.4|13106.m00134|protein
Sequence length 1153
Comment AMP-binding enzyme family protein, expressed
Sequence
MAAEAAAAKEEEPCCISHAFDRAARRNPTGLAVIHAASSSSSGSDSERHFTCADLLAAVS
TLSRHIAAELSSSTSRHRDESPGCSGRPVEAAAAPRVVGVYASPSVEYIAAVLAVLRCGE
AFLPLDPSWPEERIRWATSSSNAVLVVSSGGLGAAHVFASSSCSVIHMDDDLWQVFEDEK
GGIGRDELAWPCKYKKPREFCYVMFTSGSTGKPKGVCGTEKGLLNRFLWMQRWKPLCSDD
LLLFKTSVSFVDHLQEFLSAVLTCTTLVIPPPNDWRANPASLANLIKAYGISRMNLVPSL
MEIILPSLEKNLSWGHNPLKMLIFSGENLSILLWKRVHEILPETTIVNLYGTTEVSGDCT
FFDCTDLPILLKREELTSVPIGFPISNCEVCIATDAEVADEGEMHVTGACLFAGYLEESM
ASNHTEDNGSSTYYRTGDFARRLKSGEFIFLGRKDRTVKIYGQRFSLQEVESTLNEHPDV
SAAAVTFQNNEFLDFRAYLVLKSSAASVEDCQRRKRYKSFEVIMPSIRSWLIMKLPPAMI
PRFFLPMESLPLTSSGKIDYMKLSSLKCALESCETETERITVNPHLQVIKKAFSDALLVD
EVSEFDDFFTLGGNSISAAHVAHKLEIDMRMLYIYSTPSKLLDALFTKHGCLLSSSHEPH
PKKGLDISSSIHSSFNPIATSVDDNFPEVKAHINGDGECAHDAISGNYANEVDGQLNRNV
PLSNDRYQTKSLLLDTCSNDRNSVDVSPWILNFCLVKKWSIGRCNRFMHGYEDKLQIEDV
CSYVPYNKRGYLQALWNIPLGSCVDASPLLVSNNGMLSIFIGSHSHRFLCIDGCSGSVRW
SVKLEGRVECSAAITGDFSEVVVGCYKGKIYFLDLLTGKQAWTIQTDGEVKMQPAVDMIR
NLIWCGSYDHHLYALNYKDRCCTYKISCGGSIYGSPAIDMTHNMIYVASTSGLVTAISLE
VSSFKIIWQYEAGAPIFGSLAIHHHGGKVICCLVNGLVIALNSHGSVVWKASVGGPIFAG
ACLSSGLPTQVLIPSRDGRLYSFDTTSGALLWKYEVGDPITASAFVDEVLTATSPGASER
FACICTSSGQVHVIRIRADAKEEKVNGSICNDLVQGFAAIDLPGDIFSSPLMVGGRIFVG
CRDDQLHCLTISS
Download sequence
Identical sequences XP_015642941.1.37577 XP_015642942.1.37577 XP_015642943.1.37577 XP_015642945.1.37577 XP_015642946.1.37577 XP_015642947.1.37577 39947.LOC_Os06g02160.2 LOC_Os06g02160.1|13106.m00131|protein LOC_Os06g02160.2|13106.m00132|protein LOC_Os06g02160.3|13106.m00133|protein LOC_Os06g02160.4|13106.m00134|protein LOC_Os06g02160.1|PACid:21932357 LOC_Os06g02160.2|PACid:21932358 LOC_Os06g02160.3|PACid:21932359 LOC_Os06g02160.4|PACid:21932360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]