SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os06g09230.2|13106.m00986|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os06g09230.2|13106.m00986|protein
Domain Number 1 Region: 428-713
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-69
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 18-138
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000167
Family N-type ATP pyrophosphatases 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os06g09230.2|13106.m00986|protein
Sequence length 787
Comment serine threonine kinase, putative, expressed
Sequence
MERYHDGKDLDTSSYPLVAVCIDKDKNSQNALKWAIDTLVQKGQIIVLVHVNTKGTSGGV
EDASGFKQPTDPHMRDLYRTFRCFCTRKDIQCKDVLLDDHDVAKSITEFCAVAAIEKLVV
GATARGGFRFKADIPTTISKGAPDFCTVYVINKGKVSSVRNSTRQAPRVSPLRSQIQNMA
AAAAKPEPATAMAPTPQKWSSSSRGHDHLETPKVDSYIRSPFARGPMGGATRKSYADLSH
LSMPDSADISFVSSGRRSVEHNPVPARLSAASAESYDHSFETSRTPWGGDSFGGNDHTSF
SQSSTSSFCSIGMDDVETEMKRLRLELKQTMDMYSTACKEALNAKQKAMELQRWKAEEEQ
RTHDARLTEESAMALIEREKAKAKAAMDAAEASQRIAELEVQKRITAEKKLLKEAEDRKN
RGGGGGGMSHEIRYRRYSIEEIEHATDRFNDARKIGEGGYGPVYKGHLDHTAVAIKVLRP
DAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDCLFRRGGGGGG
GGGPVIPWQHRFRIAAEIATGLLFLHQTKPEPLVHRDLKPGNILLDRNYVSKISDVGLAR
LVPPNVADNVTQYRMTSTAGTFCYIDPEYQQTGMLGVKSDVYSLGVMLLQIITAKPPMGL
THHVGRAMERGALADMLDPAVPDWPVEEAQCLAEMALRCCELRRKDRPDLGSAVLPELNR
LRALGEDNMQFCGAIRGGVGGGLYSSSLLSTPSRSQAAEFMGDSQYPRSVFSSRTGESPM
PLRRSNV
Download sequence
Identical sequences XP_015643441.1.37577 LOC_Os06g09230.2|PACid:21930454 LOC_Os06g09230.2|13106.m00986|protein 39947.LOC_Os06g09230.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]